GATA2 monoclonal antibody (M01), clone 2D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GATA2.
Immunogen
GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GATA2 monoclonal antibody (M01), clone 2D11 Western Blot analysis of GATA2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of GATA2 expression in transfected 293T cell line by GATA2 monoclonal antibody (M01), clone 2D11.
Lane 1: GATA2 transfected lysate(50.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GATA2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GATA2 over-expressed 293 cell line, cotransfected with GATA2 Validated Chimera RNAi ( Cat # H00002624-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GATA2 monoclonal antibody (M01), clone 2D11 (Cat # H00002624-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to GATA2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GATA2
Entrez GeneID
2624GeneBank Accession#
BC018988Protein Accession#
AAH18988Gene Name
GATA2
Gene Alias
MGC2306, NFE1B
Gene Description
GATA binding protein 2
Omim ID
137295Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants
Other Designations
GATA-binding protein 2
-
Interactome
-
Disease
-
Publication Reference
-
Single-cell epigenomic variability reveals functional cancer heterogeneity.
Litzenburger UM, Buenrostro JD, Wu B, Shen Y, Sheffield NC, Kathiria A, Greenleaf WJ, Chang HY.
Genome Biology 2017 Jan; 18(1):15.
Application:Flow Cyt, Human, K-562 cells.
-
Single-cell epigenomic variability reveals functional cancer heterogeneity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com