GAS2 monoclonal antibody (M01), clone 4E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GAS2.
Immunogen
GAS2 (NP_005247, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GAS2 monoclonal antibody (M01), clone 4E11 Western Blot analysis of GAS2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of GAS2 expression in transfected 293T cell line by GAS2 monoclonal antibody (M01), clone 4E11.
Lane 1: GAS2 transfected lysate(34.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAS2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GAS2 on NIH/3T3 cell. [antibody concentration 10 ug/ml] -
Gene Info — GAS2
Entrez GeneID
2620GeneBank Accession#
NM_005256Protein Accession#
NP_005247Gene Name
GAS2
Gene Alias
MGC32610
Gene Description
growth arrest-specific 2
Omim ID
602835Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
p53-dependent translational control of senescence and transformation via 4E-BPs.
Petroulakis E, Parsyan A, Dowling RJ, LeBacquer O, Martineau Y, Bidinosti M, Larsson O, Alain T, Rong L, Mamane Y, Paquet M, Furic L, Topisirovic I, Shahbazian D, Livingstone M, Costa-Mattioli M, Teodoro JG, Sonenberg N.
Cancer Cell 2009 Nov; 16(5):439.
Application:WB-Tr, Mouse, MEFs.
-
p53-dependent translational control of senescence and transformation via 4E-BPs.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com