Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GAPDH polyclonal antibody (A01)

  • Catalog # : H00002597-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GAPDH.
  • Immunogen:
  • GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002597-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2597
  • Gene Name:
  • GAPDH
  • Gene Alias:
  • G3PD,GAPD,MGC88685
  • Gene Description:
  • glyceraldehyde-3-phosphate dehydrogenase
  • Gene Summary:
  • The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000174431,OTTHUMP00000174432,aging-associated gene 9 protein,glyceraldehyde 3-phosphate dehydrogenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook