GAP43 monoclonal antibody (M01), clone 3C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GAP43 expression in transfected 293T cell line by GAP43 monoclonal antibody (M01), clone 3C11.
Lane 1: GAP43 transfected lysate(24.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAP43 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.92 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant GAP43.
Immunogen
GAP43 (AAH07936, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GAP43 expression in transfected 293T cell line by GAP43 monoclonal antibody (M01), clone 3C11.
Lane 1: GAP43 transfected lysate(24.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAP43 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — GAP43
Entrez GeneID
2596GeneBank Accession#
BC007936Protein Accession#
AAH07936Gene Name
GAP43
Gene Alias
B-50, PP46
Gene Description
growth associated protein 43
Omim ID
162060Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
axonal membrane protein GAP-43|calmodulin-binding protein P-57|nerve growth-related peptide GAP43|neural phosphoprotein B-50|neuromodulin|neuron growth-associated protein 43|protein F1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com