Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GAP43 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00002596-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human GAP43 protein.
  • Immunogen:
  • GAP43 (NP_002036.1, 1 a.a. ~ 238 a.a) full-length human protein.
  • Sequence:
  • MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GAP43 expression in transfected 293T cell line (H00002596-T02) by GAP43 MaxPab polyclonal antibody.

    Lane 1: GAP43 transfected lysate(24.80 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2596
  • Gene Name:
  • GAP43
  • Gene Alias:
  • B-50,PP46
  • Gene Description:
  • growth associated protein 43
  • Gene Summary:
  • The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • axonal membrane protein GAP-43,calmodulin-binding protein P-57,nerve growth-related peptide GAP43,neural phosphoprotein B-50,neuromodulin,neuron growth-associated protein 43,protein F1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook