GAP43 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GAP43 MaxPab polyclonal antibody. Western Blot analysis of GAP43 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of GAP43 expression in transfected 293T cell line (H00002596-T01) by GAP43 MaxPab polyclonal antibody.
Lane 1: GAP43 transfected lysate(26.29 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GAP43 protein.
Immunogen
GAP43 (AAH07936, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GAP43 MaxPab polyclonal antibody. Western Blot analysis of GAP43 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of GAP43 expression in transfected 293T cell line (H00002596-T01) by GAP43 MaxPab polyclonal antibody.
Lane 1: GAP43 transfected lysate(26.29 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GAP43
Entrez GeneID
2596GeneBank Accession#
BC007936Protein Accession#
-Gene Name
GAP43
Gene Alias
B-50, PP46
Gene Description
growth associated protein 43
Omim ID
162060Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
axonal membrane protein GAP-43|calmodulin-binding protein P-57|nerve growth-related peptide GAP43|neural phosphoprotein B-50|neuromodulin|neuron growth-associated protein 43|protein F1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com