GALNT1 monoclonal antibody (M10), clone 3C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GALNT1 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to GALNT1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (34.76 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GALNT1.
Immunogen
GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GALNT1 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GALNT1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GALNT1
Entrez GeneID
2589GeneBank Accession#
NM_020474Protein Accession#
NP_065207Gene Name
GALNT1
Gene Alias
GALNAC-T1
Gene Description
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1)
Omim ID
602273Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq
Other Designations
GalNAc transferase 1|UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1|polypeptide N-acetylgalactosaminyltransferase 1|protein-UDP acetylgalactosaminyltransferase 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
GALNT1 Enhances Malignant Phenotype of Gastric Cancer via Modulating CD44 Glycosylation to Activate the Wnt/β-catenin Signaling Pathway.
Junchang Zhang, Han Wang, Jing Wu, Cheng Yuan, Songyao Chen, Shuhao Liu, Mingyu Huo, Changhua Zhang, Yulong He.
International Journal of Biological Sciences 2022 Oct; 18(16):6068.
Application：IF, Human, AGS, MKN45, SGC7901 cells.
-
GALNT1 Enhances Malignant Phenotype of Gastric Cancer via Modulating CD44 Glycosylation to Activate the Wnt/β-catenin Signaling Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com