Product Browser

Last updated: 2014/9/15
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

B4GALNT1 polyclonal antibody (A01)

  • Catalog # : H00002583-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant B4GALNT1.
  • Immunogen:
  • B4GALNT1 (NP_001469, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002583-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2583
  • Gene Name:
  • B4GALNT1
  • Gene Alias:
  • GALGT,GALNACT
  • Gene Description:
  • beta-1,4-N-acetyl-galactosaminyl transferase 1
  • Gene Summary:
  • GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. [provided by RefSeq
  • Other Designations:
  • GD2 synthase, GM2 synthase,GalNAc-T,UDP-Gal:betaGlcNAc beta-1,4-N-acetylgalactosaminyltransferase transferase 1,UDP-N-acetyl-alpha-D-galactosamine:(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase (GalNAc-T),beta1,4GalNAc-T
  • RSS
  • YouTube
  • Linkedin
  • Facebook