GAK monoclonal antibody (M01), clone 4C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GAK monoclonal antibody (M01), clone 4C10 Western Blot analysis of GAK expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of GAK expression in transfected 293T cell line by GAK monoclonal antibody (M01), clone 4C10.
Lane 1: GAK transfected lysate (Predicted MW: 44 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of GAK transfected lysate using anti-GAK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GAK monoclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAK is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GAK.
Immunogen
GAK (AAH08668, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GAK monoclonal antibody (M01), clone 4C10 Western Blot analysis of GAK expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of GAK expression in transfected 293T cell line by GAK monoclonal antibody (M01), clone 4C10.
Lane 1: GAK transfected lysate (Predicted MW: 44 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of GAK transfected lysate using anti-GAK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GAK monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAK is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — GAK
Entrez GeneID
2580GeneBank Accession#
BC008668Protein Accession#
AAH08668Gene Name
GAK
Gene Alias
FLJ16629, FLJ40395, MGC99654
Gene Description
cyclin G associated kinase
Omim ID
602052Gene Ontology
HyperlinkGene Summary
In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com