GABPB2 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GABPB2 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of GABPB2 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (35.68 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GABPB2.
Immunogen
GABPB2 (NP_002032, 274 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
Sequence
TIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEVRSLLPGVLCRSHPK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.68 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GABPB2 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of GABPB2 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — GABPB1
Entrez GeneID
2553GeneBank Accession#
NM_002041Protein Accession#
NP_002032Gene Name
GABPB1
Gene Alias
BABPB2, E4TF1, E4TF1-47, E4TF1-53, E4TF1B, GABPB, GABPB2, NRF2B1, NRF2B2
Gene Description
GA binding protein transcription factor, beta subunit 1
Omim ID
600610Gene Ontology
HyperlinkGene Summary
This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
A Hepatic GAbp-AMPK Axis Links Inflammatory Signaling to Systemic Vascular Damage.
Niopek K, Üstünel BE, Seitz S, Sakurai M, Zota A, Mattijssen F, Wang X, Sijmonsma T, Feuchter Y, Gail AM, Leuchs B, Niopek D, Staufer O, Brune M, Sticht C, Gretz N, Müller-Decker K, Hammes HP, Nawroth P, Fleming T, Conkright MD, Blüher M, Zeigerer A, Herzig S, Berriel Diaz M.
Cell Reports 2017 Aug; 20(6):1422.
Application：IP-WB, Human, Hepa1-6 cells.
-
A Hepatic GAbp-AMPK Axis Links Inflammatory Signaling to Systemic Vascular Damage.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com