GABBR1 monoclonal antibody (M01J), clone 2D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GABBR1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
GABBR1 (AAH50532.2, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (100)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GABBR1 monoclonal antibody (M01J), clone 2D7. Western Blot analysis of GABBR1 expression in IMR-32.Western Blot (Transfected lysate)
Western Blot analysis of GABBR1 expression in transfected 293T cell line by GABBR1 monoclonal antibody (M01J), clone 2D7.
Lane 1: GABBR1 transfected lysate (Predicted MW: 95.0999999 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GABBR1 is 0.03 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of GABBR1 over-expressed 293 cell line, cotransfected with GABBR1 Validated Chimera RNAi ( Cat # H00002550-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GABBR1 monoclonal antibody (M01), clone 2D7 (Cat # H00002550-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to GABBR1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GABBR1
Entrez GeneID
2550GeneBank Accession#
BC050532.1Protein Accession#
AAH50532.2Gene Name
GABBR1
Gene Alias
FLJ92613, GABAB(1e), GABABR1, GABBR1-3, GPRC3A, dJ271M21.1.1, dJ271M21.1.2, hGB1a
Gene Description
gamma-aminobutyric acid (GABA) B receptor, 1
Omim ID
603540Gene Ontology
HyperlinkGene Summary
Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq
Other Designations
GABA-B receptor|GABAB, subunit 1c|OTTHUMP00000029114|OTTHUMP00000029115|OTTHUMP00000029116|OTTHUMP00000109099|gamma-aminobutyric acid (GABA) B receptor 1|seven transmembrane helix receptor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com