Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GABBR1 monoclonal antibody (M01), clone 2D7

  • Catalog # : H00002550-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant GABBR1.
  • Immunogen:
  • GABBR1 (AAH50532, 52 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002550-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 1.
  • Limbic encephalitis due to GABAB and AMPA receptor antibodies: a case series.
    Dogan Onugoren M, Deuretzbacher D, Haensch CA, Hagedorn HJ, Halve S, Isenmann S, Kramme C, Lohner H, Melzer N, Monotti R, Presslauer S, Schabitz WR, Steffanoni S, Stoeck K, Strittmatter M, Stogbauer F, Trinka E, von Oertzen TJ, Wiendl H, Woermann FG, Bien CGJ Neurol Neurosurg Psychiatry. 2014 Oct 9. pii: jnnp-2014-308814. doi: 10.1136/jnnp-2014-308814.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • GABBR1 monoclonal antibody (M01), clone 2D7 Western Blot analysis of GABBR1 expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GABBR1 expression in transfected 293T cell line by GABBR1 monoclonal antibody (M01), clone 2D7.

    Lane 1: GABBR1 transfected lysate(95 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged GABBR1 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of GABBR1 over-expressed 293 cell line, cotransfected with GABBR1 Validated Chimera RNAi ( Cat # H00002550-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GABBR1 monoclonal antibody (M01), clone 2D7 (Cat # H00002550-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2550
  • Gene Name:
  • GABBR1
  • Gene Alias:
  • FLJ92613,GABAB(1e),GABABR1,GABBR1-3,GPRC3A,dJ271M21.1.1,dJ271M21.1.2,hGB1a
  • Gene Description:
  • gamma-aminobutyric acid (GABA) B receptor, 1
  • Gene Summary:
  • Gamma-aminobutyric acid (GABA) is the main inhibitory neurotransmitter in the mammalian central nervous system. GABA exerts its effects through ionotropic [GABA(A/C)] receptors, to produce fast synaptic inhibition, and metabotropic [GABA(B)] receptors, to produce slow, prolonged inhibitory signals. The GABA(B) receptor consists of a heterodimer of two related 7-transmembrane receptors, GABA(B) receptor 1 and GABA(B) receptor 2. The GABA(B) receptor 1 gene is mapped to chromosome 6p21.3 within the HLA class I region close to the HLA-F gene. Susceptibility loci for multiple sclerosis, epilepsy, and schizophrenia have also been mapped in this region. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • GABA-B receptor,GABAB, subunit 1c,OTTHUMP00000029114,OTTHUMP00000029115,OTTHUMP00000029116,OTTHUMP00000109099,gamma-aminobutyric acid (GABA) B receptor 1,seven transmembrane helix receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook