GAGE1 monoclonal antibody (M04), clone 4G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of GAGE1 expression in transfected 293T cell line by GAGE1 monoclonal antibody (M04), clone 4G6.
Lane 1: GAGE1 transfected lysate (Predicted MW: 15.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAGE1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant GAGE1.
Immunogen
GAGE1 (NP_001459.2, 1 a.a. ~ 139 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of GAGE1 expression in transfected 293T cell line by GAGE1 monoclonal antibody (M04), clone 4G6.
Lane 1: GAGE1 transfected lysate (Predicted MW: 15.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GAGE1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — GAGE1
Entrez GeneID
2543GeneBank Accession#
NM_001468.3Protein Accession#
NP_001459.2Gene Name
GAGE1
Gene Alias
MGC33825
Gene Description
G antigen 1
Omim ID
300594Gene Ontology
HyperlinkGene Summary
This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs.The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene. [provided by RefSeq
Other Designations
MZ2-F antigen|OTTHUMP00000025848
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com