Product Browser

Last updated: 2017/3/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC37A4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002542-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC37A4 partial ORF ( NP_001458.1, 28 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.13
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002542-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2542
  • Gene Name:
  • SLC37A4
  • Gene Alias:
  • G6PT1,G6PT2,G6PT3,GSD1b,GSD1c,GSD1d,MGC15729,PRO0685,TRG19
  • Gene Description:
  • solute carrier family 37 (glucose-6-phosphate transporter), member 4
  • Gene Summary:
  • This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants
  • Other Designations:
  • glucose-6-phosphatase, transport (glucose) protein 3,glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1,glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2,glucose-6-phosphate translocase,glucose-6-phosphate transporter 1,mi
  • RSS
  • YouTube
  • Linkedin
  • Facebook