Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC37A4 monoclonal antibody (M01), clone 7B9

  • Catalog # : H00002542-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant SLC37A4.
  • Immunogen:
  • SLC37A4 (NP_001458.1, 28 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002542-M01
    Western Blot detection against Immunogen (31.13 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged SLC37A4 is 0.03 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2542
  • Gene Name:
  • SLC37A4
  • Gene Alias:
  • G6PT1,G6PT2,G6PT3,GSD1b,GSD1c,GSD1d,MGC15729,PRO0685,TRG19
  • Gene Description:
  • solute carrier family 37 (glucose-6-phosphate transporter), member 4
  • Gene Summary:
  • This gene regulates glucose-6-phosphate transport from the cytoplasm to the lumen of the endoplasmic reticulum, in order to maintain glucose homeostasis. It also plays a role in ATP-mediated calcium sequestration in the lumen of the endoplasmic reticulum. Mutations in this gene have been associated with various forms of glycogen storage disease. Alternative splicing in this gene results in multiple transcript variants
  • Other Designations:
  • glucose-6-phosphatase, transport (glucose) protein 3,glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1,glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2,glucose-6-phosphate translocase,glucose-6-phosphate transporter 1,mi
  • RSS
  • YouTube
  • Linkedin
  • Facebook