Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FZD2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002535-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FZD2 partial ORF ( NP_001457, 192 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.68
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002535-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2535
  • Gene Name:
  • FZD2
  • Gene Alias:
  • -
  • Gene Description:
  • frizzled homolog 2 (Drosophila)
  • Gene Summary:
  • Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung and in adult colon and ovary. [provided by RefSeq
  • Other Designations:
  • frizzled 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook