Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DARC (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00002532-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DARC full-length ORF (NP_002027.2) recombinant protein without tag.
  • Sequence:
  • MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.6
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 2532
  • Gene Name:
  • DARC
  • Gene Alias:
  • CCBP1,CD234,Dfy,FY,GPD,GpFy,WBCQ1
  • Gene Description:
  • Duffy blood group, chemokine receptor
  • Gene Summary:
  • The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Duffy antigen/chemokine receptor,Duffy blood group antigen,Fy glycoprotein,OTTHUMP00000035293,OTTHUMP00000060081,glycoprotein D
  • RSS
  • YouTube
  • Linkedin
  • Facebook