FVT1 monoclonal antibody (M01), clone 2B2-3C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FVT1 monoclonal antibody (M01), clone 2B2-3C11 Western Blot analysis of FVT1 expression in Jurkat ( Cat # L017V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FVT1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (61.05 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FVT1.
Immunogen
FVT1 (AAH08797.1, 12 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.05 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FVT1 monoclonal antibody (M01), clone 2B2-3C11 Western Blot analysis of FVT1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FVT1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — KDSR
Entrez GeneID
2531GeneBank Accession#
BC008797Protein Accession#
AAH08797.1Gene Name
KDSR
Gene Alias
DHSR, FLJ36555, FLJ92680, FVT1, SDR35C1
Gene Description
3-ketodihydrosphingosine reductase
Omim ID
136440Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. [provided by RefSeq
Other Designations
3-dehydrosphinganine reductase|KDS reductase|follicular lymphoma variant translocation 1|short chain dehydrogenase/reductase family 35C, member 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com