Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FUT7 polyclonal antibody (A01)

  • Catalog # : H00002529-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FUT7.
  • Immunogen:
  • FUT7 (NP_004470, 262 a.a. ~ 342 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002529-A01
    Western Blot detection against Immunogen (35.02 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2529
  • Gene Name:
  • FUT7
  • Gene Alias:
  • FucT-VII
  • Gene Description:
  • fucosyltransferase 7 (alpha (1,3) fucosyltransferase)
  • Gene Summary:
  • The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022654,alpha-(1,3)-fucosyltransferase,fucosyltransferase 7,galactoside 3-L-fucosyltransferase,selectin-ligand synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook