FUT3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FUT3 partial ORF ( NP_000140.1, 82 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
33.33
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FUT3
Entrez GeneID
2525GeneBank Accession#
NM_000149Protein Accession#
NP_000140.1Gene Name
FUT3
Gene Alias
CD174, FT3B, FucT-III, LE, Les, MGC131739
Gene Description
fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group)
Omim ID
111100Gene Ontology
HyperlinkGene Summary
The Lewis histo-blood group system comprises a set of fucosylated glycosphingolipids that are synthesized by exocrine epithelial cells and circulate in body fluids. The glycosphingolipids function in embryogenesis, tissue differentiation, tumor metastasis, inflammation, and bacterial adhesion. They are secondarily absorbed to red blood cells giving rise to their Lewis phenotype. This gene is a member of the fucosyltransferase family, which catalyzes the addition of fucose to precursor polysaccharides in the last step of Lewis antigen biosynthesis. It encodes an enzyme with alpha(1,3)-fucosyltransferase and alpha(1,4)-fucosyltransferase activities. Mutations in this gene are responsible for the majority of Lewis antigen-negative phenotypes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq
Other Designations
Lewis FT|alpha-(1,3/1,4)-fucosyltransferase|blood group Lewis alpha-4-fucosyltransferase|fucosyltransferase 3|galactoside 3(4)-L-fucosyltransferase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com