FUT2 monoclonal antibody (M02), clone 4C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FUT2 monoclonal antibody (M02), clone 4C12 Western Blot analysis of FUT2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of FUT2 expression in transfected 293T cell line by FUT2 monoclonal antibody (M02), clone 4C12.
Lane 1: FUT2 transfected lysate(17.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FUT2.
Immunogen
FUT2 (NP_000502, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHFPGEYVRFTGY
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (80); Rat (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FUT2 monoclonal antibody (M02), clone 4C12 Western Blot analysis of FUT2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FUT2 expression in transfected 293T cell line by FUT2 monoclonal antibody (M02), clone 4C12.
Lane 1: FUT2 transfected lysate(17.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — FUT2
Entrez GeneID
2524GeneBank Accession#
NM_000511Protein Accession#
NP_000502Gene Name
FUT2
Gene Alias
SE, SEC2, Se2, sej
Gene Description
fucosyltransferase 2 (secretor status included)
Omim ID
182100Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2|alpha (1,2) fucosyltransferase|alpha(1,2)FT2|fucosyltransferase 2|galactoside 2-alpha-L-fucosyltransferase 2|secretor blood group alpha-2-fucosyltransferase|secretor factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com