Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FUT1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002523-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FUT1 full-length ORF ( NP_000139.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 67.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002523-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2523
  • Gene Name:
  • FUT1
  • Gene Alias:
  • H,HH,HSC
  • Gene Description:
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
  • Gene Summary:
  • The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq
  • Other Designations:
  • 2-alpha-L-fucosyltransferase,GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1,alpha (1,2) fucosyltransferase,blood group H alpha 2-fucosyltransferase,fucosyltransferase 1,fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase),fucosy
  • RSS
  • YouTube
  • Linkedin
  • Facebook