Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FUT1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00002523-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FUT1 protein.
  • Immunogen:
  • FUT1 (NP_000139.1, 1 a.a. ~ 365 a.a) full-length human protein.
  • Sequence:
  • MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FUT1 expression in transfected 293T cell line (H00002523-T01) by FUT1 MaxPab polyclonal antibody.

    Lane 1: FUT1 transfected lysate(40.15 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2523
  • Gene Name:
  • FUT1
  • Gene Alias:
  • H,HH,HSC
  • Gene Description:
  • fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
  • Gene Summary:
  • The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq
  • Other Designations:
  • 2-alpha-L-fucosyltransferase,GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1,alpha (1,2) fucosyltransferase,blood group H alpha 2-fucosyltransferase,fucosyltransferase 1,fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase),fucosy
  • RSS
  • YouTube
  • Linkedin
  • Facebook