Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FUCA1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002517-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FUCA1 partial ORF ( NP_000138, 362 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • EAIYASKPWRVQWEKNITSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002517-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2517
  • Gene Name:
  • FUCA1
  • Gene Alias:
  • FUCA
  • Gene Description:
  • fucosidase, alpha-L- 1, tissue
  • Gene Summary:
  • Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids (Occhiodoro et al., 1989 [PubMed 2803312]). At least 2 separate polymorphic alpha-L-fucosidases are recognized in man: that in tissues, FUCA1, which is deficient in fucosidosis (MIM 230000), and that in plasma, FUCA2 (MIM 136820).[supplied by OMIM
  • Other Designations:
  • Nbla10230/alpha-L-fucosidase,OTTHUMP00000003009,alpha-L-fucosidase,fucosidase, alpha-L-1, tissue
  • RSS
  • YouTube
  • Linkedin
  • Facebook