Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NR5A2 polyclonal antibody (A01)

  • Catalog # : H00002494-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NR5A2.
  • Immunogen:
  • NR5A2 (NP_995582, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2494
  • Gene Name:
  • NR5A2
  • Gene Alias:
  • B1F,B1F2,CPF,FTF,FTZ-F1,FTZ-F1beta,LRH-1,hB1F,hB1F-2
  • Gene Description:
  • nuclear receptor subfamily 5, group A, member 2
  • Other Designations:
  • CYP7A promoter-binding factor,OTTHUMP00000033644,OTTHUMP00000033646,b1-binding factor, hepatocyte transcription factor which activates enhancer II of hepatitis B virus,fetoprotein-alpha 1 (AFP) transcription factor,liver receptor homolog 1,liver receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook