Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MTOR (Human) Recombinant Protein (Q01)

  • Catalog # : H00002475-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MTOR partial ORF ( NP_004949, 1521 a.a. - 1620 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002475-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2475
  • Gene Name:
  • MTOR
  • Gene Alias:
  • FRAP,FRAP1,FRAP2,RAFT1,RAPT1
  • Gene Description:
  • mechanistic target of rapamycin
  • Gene Summary:
  • The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. [provided by RefSeq
  • Other Designations:
  • FK506 binding protein 12-rapamycin associated protein 1,FK506 binding protein 12-rapamycin associated protein 2,FK506-binding protein 12-rapamycin complex-associated protein 1,FKBP-rapamycin associated protein,FKBP12-rapamycin complex-associated protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook