Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FPR2 monoclonal antibody (M02), clone 2D8

  • Catalog # : H00002358-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FPR2.
  • Immunogen:
  • FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002358-M02
    Western Blot detection against Immunogen (30.36 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FPR2 monoclonal antibody (M02), clone 2D8. Western Blot analysis of FPR2 expression in Hela S3 NE.
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged FPR2 is approximately 10ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2358
  • Gene Name:
  • FPR2
  • Gene Alias:
  • ALXR,FMLP-R-II,FMLPX,FPR2A,FPRH1,FPRH2,FPRL1,HM63,LXA4R
  • Gene Description:
  • formyl peptide receptor 2
  • Other Designations:
  • formyl peptide receptor-like 1,lipoxin A4 receptor (formyl peptide receptor related)
  • RSS
  • YouTube
  • Linkedin
  • Facebook