Product Browser

Last updated: 2017/5/28
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FPGS polyclonal antibody (A01)

  • Catalog # : H00002356-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FPGS.
  • Immunogen:
  • FPGS (NP_004948, 135 a.a. ~ 232 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QVRERIRINGQPISPELFTKYFWRLYHRLEETKDGSCVSMPPYFRFLTLMAFHVFLQEKVDLAVVEVGIGGAYDCTNIIRKPVVCGVSSLGIDHTSLL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002356-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2356
  • Gene Name:
  • FPGS
  • Gene Alias:
  • -
  • Gene Description:
  • folylpolyglutamate synthase
  • Gene Summary:
  • This gene encodes the folylpolyglutamate synthetase enzyme. This enzyme has a central role in establishing and maintaining both cytosolic and mitochondrial folylpolyglutamate concentrations and, therefore, is essential for folate homeostasis and the survival of proliferating cells. This enzyme catalyzes the ATP-dependent addition of glutamate moieties to folate and folate derivatives. While several transcript variants may exist for this gene, the full-length natures of only two have been biologically validated to date. These two variants encode distinct isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022201,OTTHUMP00000022202,folylpoly-gamma-glutamate synthetase,folylpolyglutamate synthetase,tetrahydrofolylpolyglutamate synthase
  • RSS
  • YouTube
  • Linkedin
  • Facebook