FOLR1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FOLR1 protein.
Immunogen
FOLR1 (AAH02947, 1 a.a. ~ 257 a.a) full-length human protein.
Sequence
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FOLR1 expression in transfected 293T cell line (H00002348-T01) by FOLR1 MaxPab polyclonal antibody.
Lane 1: FOLR1 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FOLR1
Entrez GeneID
2348GeneBank Accession#
BC002947Protein Accession#
-Gene Name
FOLR1
Gene Alias
FBP, FOLR, FR-alpha, MOv18
Gene Description
folate receptor 1 (adult)
Omim ID
136430Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the folate receptor (FOLR) family. Members of this gene family have a high affinity for folic acid and for several reduced folic acid derivatives, and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. This gene is composed of 7 exons; exons 1 through 4 encode the 5' UTR and exons 4 through 7 encode the open reading frame. Due to the presence of 2 promoters, multiple transcription start sites, and alternative splicing of exons, several transcript variants are derived from this gene. These variants differ in the lengths of 5' and 3' UTR, but they encode an identical amino acid sequence. [provided by RefSeq
Other Designations
folate binding protein|folate receptor 1
-
Interactome
-
Disease
-
Publication Reference
-
Ligand density and clustering effects on endocytosis of folate modified nanoparticles.
Emilia Moradi, Driton Vllasaliu,a Martin Garnett, Franco Falconeb and Snow Stolnik.
RSC Advances 2012 Feb; 2:3025.
Application:IF, Human, Calu-3 cells.
-
Ligand density and clustering effects on endocytosis of folate modified nanoparticles.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com