Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOLH1 polyclonal antibody (A01)

  • Catalog # : H00002346-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FOLH1.
  • Immunogen:
  • FOLH1 (AAH25672, 547 a.a. ~ 656 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002346-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2346
  • Gene Name:
  • FOLH1
  • Gene Alias:
  • FGCP,FOLH,GCP2,GCPII,NAALAD1,NAALAdase,PSM,PSMA,mGCP
  • Gene Description:
  • folate hydrolase (prostate-specific membrane antigen) 1
  • Gene Summary:
  • This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • N-acetylated alpha-linked acidic dipeptidase 1,cell growth-inhibiting protein 27,folate hydrolase 1,folylpoly-gamma-glutamate carboxypeptidase,glutamate carboxylase II,glutamate carboxypeptidase II,membrane glutamate carboxypeptidase,prostate specific mem
  • RSS
  • YouTube
  • Linkedin
  • Facebook