Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FNTA MaxPab mouse polyclonal antibody (B02)MaxPab

  • Catalog # : H00002339-B02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FNTA protein.
  • Immunogen:
  • FNTA (AAH37295.1, 1 a.a. ~ 214 a.a) full-length human protein.
  • Sequence:
  • MSCTVRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQLVISFTCSFVTNMFACLPYLRHWGYSRSRSYPMELKEDRVLSGT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FNTA expression in transfected 293T cell line (H00002339-T03) by FNTA MaxPab polyclonal antibody.

    Lane 1: FNTA transfected lysate(26.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2339
  • Gene Name:
  • FNTA
  • Gene Alias:
  • FPTA,MGC99680,PGGT1A,PTAR2
  • Gene Description:
  • farnesyltransferase, CAAX box, alpha
  • Gene Summary:
  • Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • FTase-alpha,GGTase-I-alpha,farnesyltransferase alpha-subunit,protein prenyltransferase alpha subunit repeat containing 2,ras proteins prenyltransferase alpha,type I protein geranyl-geranyltransferase alpha subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook