Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FN1 (Human) Recombinant Protein (P01)

  • Catalog # : H00002335-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FN1 full-length ORF ( AAH05858, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.56
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002335-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2335
  • Gene Name:
  • FN1
  • Gene Alias:
  • CIG,DKFZp686F10164,DKFZp686H0342,DKFZp686I1370,DKFZp686O13149,ED-B,FINC,FN,FNZ,GFND,GFND2,LETS,MSF
  • Gene Description:
  • fibronectin 1
  • Gene Summary:
  • This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. [provided by RefSeq
  • Other Designations:
  • cold-insoluble globulin,migration-stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook