Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FN1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00002335-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FN1 protein.
  • Immunogen:
  • FN1 (AAH05858, 1 a.a. ~ 163 a.a) full-length human protein.
  • Sequence:
  • MSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FN1 MaxPab polyclonal antibody. Western Blot analysis of FN1 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FN1 expression in transfected 293T cell line (H00002335-T01) by FN1 MaxPab polyclonal antibody.

    Lane 1: FN1 transfected lysate(23.21 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between HGF and FN1. HeLa cells were stained with anti-HGF rabbit purified polyclonal 1:1200 and anti-FN1 mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2335
  • Gene Name:
  • FN1
  • Gene Alias:
  • CIG,DKFZp686F10164,DKFZp686H0342,DKFZp686I1370,DKFZp686O13149,ED-B,FINC,FN,FNZ,GFND,GFND2,LETS,MSF
  • Gene Description:
  • fibronectin 1
  • Gene Summary:
  • This gene encodes fibronectin, a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis. The gene has three regions subject to alternative splicing, with the potential to produce 20 different transcript variants. However, the full-length nature of some variants has not been determined. [provided by RefSeq
  • Other Designations:
  • cold-insoluble globulin,migration-stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook