Product Browser

Last updated: 2017/4/23
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLT1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002321-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FLT1 partial ORF ( AAH39007, 581 a.a. - 687 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHCNKKAVFSRISKFKSTRNDCTTQSNVKH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002321-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2321
  • Gene Name:
  • FLT1
  • Gene Alias:
  • FLT,VEGFR1
  • Gene Description:
  • fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
  • Gene Summary:
  • This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia
  • Other Designations:
  • fms-related tyrosine kinase 1,soluble VEGF receptor 1-14,soluble VEGFR1 variant 2,soluble VEGFR1 variant 21,vascular endothelial growth factor/vascular permeability factor receptor
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook