Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLOT2 monoclonal antibody (M03), clone 3G6

  • Catalog # : H00002319-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant FLOT2.
  • Immunogen:
  • FLOT2 (AAH17292, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002319-M03
    Western Blot detection against Immunogen (67.43 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FLOT2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of FLOT2 expression in human stomach.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FLOT2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of FLOT2 expression in A-431.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FLOT2 expression in transfected 293T cell line by FLOT2 monoclonal antibody (M03), clone 3G6.

    Lane 1: FLOT2 transfected lysate (Predicted MW: 41.7 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of FLOT2 transfected lysate using anti-FLOT2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FLOT2 monoclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2319
  • Gene Name:
  • FLOT2
  • Gene Alias:
  • ECS-1,ECS1,ESA,ESA1,M17S1
  • Gene Description:
  • flotillin 2
  • Gene Summary:
  • Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq
  • Other Designations:
  • Flotillin 2 (epidermal surface antigen 1),membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal antibody ECS-1)
  • RSS
  • YouTube
  • Linkedin
  • Facebook