Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FLNC (Human) Recombinant Protein (Q01)

  • Catalog # : H00002318-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FLNC partial ORF ( NP_001449.3, 2606 a.a. - 2705 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002318-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2318
  • Gene Name:
  • FLNC
  • Gene Alias:
  • ABP-280,ABP280A,ABPA,ABPL,FLJ10186,FLN2
  • Gene Description:
  • filamin C, gamma (actin binding protein 280)
  • Gene Summary:
  • This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ABP-L, gamma filamin,actin-binding protein 280,filamin 2,filamin C, gamma (actin-binding protein-280),gamma actin-binding protein,gamma filamin,gamma-filamin
  • RSS
  • YouTube
  • Linkedin
  • Facebook