FLNC polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant FLNC.
Immunogen
FLNC (NP_001449.3, 2606 a.a. ~ 2705 a.a) partial recombinant protein with GST tag.
Sequence
SSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FLNC polyclonal antibody (A01), Lot # FAK0070504QCS1 Western Blot analysis of FLNC expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — FLNC
Entrez GeneID
2318GeneBank Accession#
NM_001458Protein Accession#
NP_001449.3Gene Name
FLNC
Gene Alias
ABP-280, ABP280A, ABPA, ABPL, FLJ10186, FLN2
Gene Description
filamin C, gamma (actin binding protein 280)
Omim ID
102565Gene Ontology
HyperlinkGene Summary
This gene encodes one of three related filamin genes, specifically gamma filamin. These filamin proteins crosslink actin filaments into orthogonal networks in cortical cytoplasm and participate in the anchoring of membrane proteins for the actin cytoskeleton. Three functional domains exist in filamin: an N-terminal filamentous actin-binding domain, a C-terminal self-association domain, and a membrane glycoprotein-binding domain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
ABP-L, gamma filamin|actin-binding protein 280|filamin 2|filamin C, gamma (actin-binding protein-280)|gamma actin-binding protein|gamma filamin|gamma-filamin
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
The cochaperone BAG3 coordinates protein synthesis and autophagy under mechanical strain through spatial regulation of mTORC1.
Kathage B, Gehlert S, Ulbricht A, Lüdecke L, Tapia VE, Orfanos Z, Wenzel D, Bloch W, Volkmer R, Fleischmann BK, Fürst DO, Höhfeld J.
Biochimica et Biophysica Acta 2016 Oct; 1864(1):62.
Application:IF, Human, Human leg muscle.
-
Junctional Rab13-binding protein (JRAB) regulates cell spreading via filamins.
Sakane A, Alamir Mahmoud Abdallah A, Nakano K, Honda K, Kitamura T, Imoto I, Matsushita N, Sasaki T.
Genes to Cells 2013 Sep; 18(9):810.
Application:WB, Mouse, NIH3T3 cells.
-
Urine proteomics for discovery of improved diagnostic markers of Kawasaki disease.
Kentsis A, Shulman A, Ahmed S, Brennan E, Monuteaux MC, Lee YH, Lipsett S, Paulo JA, Dedeoglu F, Fuhlbrigge R, Bachur R, Bradwin G, Arditi M, Sundel RP, Newburger JW, Steen H, Kim S.
EMBO Molecular Medicine 2012 Dec; 5(2):210.
Application:WB, Human, Urine.
-
The cochaperone BAG3 coordinates protein synthesis and autophagy under mechanical strain through spatial regulation of mTORC1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com