Product Browser

Last updated: 2017/2/19
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXO3A polyclonal antibody (A01)

  • Catalog # : H00002309-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FOXO3A.
  • Immunogen:
  • FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002309-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2309
  • Gene Name:
  • FOXO3
  • Gene Alias:
  • AF6q21,DKFZp781A0677,FKHRL1,FKHRL1P2,FOXO2,FOXO3A,MGC12739,MGC31925
  • Gene Description:
  • forkhead box O3
  • Gene Summary:
  • This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016944,forkhead box O3A,forkhead homolog (rhabdomyosarcoma) like 1,forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook