Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXO1A polyclonal antibody (A01)

  • Catalog # : H00002308-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FOXO1A.
  • Immunogen:
  • FOXO1A (NP_002006, 556 a.a. ~ 655 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002308-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2308
  • Gene Name:
  • FOXO1
  • Gene Alias:
  • FKH1,FKHR,FOXO1A
  • Gene Description:
  • forkhead box O1
  • Gene Summary:
  • This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000018301,forkhead box O1A (rhabdomyosarcoma),forkhead homolog in rhabdomyosarcoma,forkhead, Drosophila, homolog of, in rhabdomyosarcoma
  • RSS
  • YouTube
  • Linkedin
  • Facebook