FKHL18 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FOXS1 MaxPab polyclonal antibody. Western Blot analysis of FOXS1 expression in 293.
Western Blot (Transfected lysate)
Western Blot analysis of FOXS1 expression in transfected 293T cell line (H00002307-T01) by FOXS1 MaxPab polyclonal antibody.
Lane 1: FKHL18 transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FKHL18 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FKHL18 protein.
Immunogen
FKHL18 (NP_004109.1, 1 a.a. ~ 330 a.a) full-length human protein.
Sequence
MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXS1 MaxPab polyclonal antibody. Western Blot analysis of FOXS1 expression in 293.Western Blot (Transfected lysate)
Western Blot analysis of FOXS1 expression in transfected 293T cell line (H00002307-T01) by FOXS1 MaxPab polyclonal antibody.
Lane 1: FKHL18 transfected lysate(36.3 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FKHL18 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FOXS1
Entrez GeneID
2307GeneBank Accession#
NM_004118.3Protein Accession#
NP_004109.1Gene Name
FOXS1
Gene Alias
FKHL18, FREAC10, MGC4544
Gene Description
forkhead box S1
Omim ID
602939Gene Ontology
HyperlinkGene Summary
The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq
Other Designations
OTTHUMP00000030540|forkhead-like 18|forkhead-related activator 10|forkhead-related transcription factor 10|forkhead-related transcription factor FREAC-10
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com