Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FKHL18 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00002307-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FKHL18 protein.
  • Immunogen:
  • FKHL18 (NP_004109.1, 1 a.a. ~ 330 a.a) full-length human protein.
  • Sequence:
  • MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FOXS1 MaxPab polyclonal antibody. Western Blot analysis of FOXS1 expression in 293.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FOXS1 expression in transfected 293T cell line (H00002307-T01) by FOXS1 MaxPab polyclonal antibody.

    Lane 1: FKHL18 transfected lysate(36.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2307
  • Gene Name:
  • FOXS1
  • Gene Alias:
  • FKHL18,FREAC10,MGC4544
  • Gene Description:
  • forkhead box S1
  • Gene Summary:
  • The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded protein is unknown. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000030540,forkhead-like 18,forkhead-related activator 10,forkhead-related transcription factor 10,forkhead-related transcription factor FREAC-10
  • RSS
  • YouTube
  • Linkedin
  • Facebook