FOXC2 monoclonal antibody (M02), clone 2H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXC2.
Immunogen
FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (89); Rat (90)
Isotype
IgG2b Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXC2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXC2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FOXC2
Entrez GeneID
2303GeneBank Accession#
NM_005251Protein Accession#
NP_005242.1Gene Name
FOXC2
Gene Alias
FKHL14, LD, MFH-1, MFH1
Gene Description
forkhead box C2 (MFH-1, mesenchyme forkhead 1)
Gene Ontology
HyperlinkGene Summary
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq
Other Designations
MFH-1,mesenchyme forkhead 1|forkhead box C2|forkhead, Drosophila, homolog-like 14|forkhead-like 14
-
Interactome
-
Disease
-
Publication Reference
-
FOXC2 expression and epithelial-mesenchymal phenotypes are associated with castration resistance, metastasis and survival in prostate cancer.
Børretzen A, Gravdal K, Haukaas SA, Beisland C, Akslen LA, Halvorsen OJ.
The Journal of Pathology. Clinical Research 2019 Oct; 5(4):272.
Application:IHC-P, Human, Human prostate cancer.
-
High expression of forkhead box protein C2 is associated with aggressive phenotypes and poor prognosis in clinical hepatocellular carcinoma.
Shimoda Y, Ubukata Y, Handa T, Yokobori T, Watanabe T, Gantumur D, Hagiwara K, Yamanaka T, Tsukagoshi M, Igarashi T, Watanabe A, Kubo N, Araki K, Harimoto N, Katayama A, Hikino T, Sano T, Ogata K, Kuwano H, Shirabe K, Oyama T.
BMC Cancer 2018 May; 18(1):597.
Application:IHC-P, Human, Hepatocellular carcinomas.
-
FOXC2 Expression is Associated with Tumor Proliferation and Invasion Potential in Oral Tongue Squamous Cell Carcinoma.
Imayama N, Yamada SI, Yanamoto S, Naruse T, Matsushita Y, Takahashi H, Seki S, Fujita S, Ikeda T, Umeda M.
Pathology Oncology Research 2015 Jul; 21(3):783.
Application:IHC-P, Human, Tongue squamous cell carcinoma.
-
MiR-520h-mediated FOXC2 regulation is critical for inhibition of lung cancer progression by resveratrol.
Yu YH, Chen HA, Chen PS, Cheng YJ, Hsu WH, Chang YW, Chen YH, Jan Y, Hsiao M, Chang TY, Liu YH, Jeng YM, Wu CH, Huang MT, Su YH, Hung MC, Chien MH, Chen CY, Kuo ML, Su JL.
Oncogene 2013 Jan; 32(4):431.
Application:WB-Ce, WB-Tr, Human, CL1-5, A-549, H322, H520, H1435 cells.
-
FOXC2 is a Novel Prognostic Factor in Human Esophageal Squamous Cell Carcinoma.
Nishida N, Mimori K, Yokobori T, Sudo T, Tanaka F, Shibata K, Ishii H, Doki Y, Mori M.
Annals of Surgical Oncology 2011 Feb; 18(2):535.
Application:IHC-P, WB-Tr, Human, Human esophageal cancer, TE-8 cells.
-
FOXC2 expression and epithelial-mesenchymal phenotypes are associated with castration resistance, metastasis and survival in prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com