Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXJ1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002302-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FOXJ1 partial ORF ( NP_001445, 341 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.65
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002302-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2302
  • Gene Name:
  • FOXJ1
  • Gene Alias:
  • FKHL13,HFH-4,HFH4,MGC35202
  • Gene Description:
  • forkhead box J1
  • Gene Summary:
  • This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis
  • Other Designations:
  • forkhead-like 13
  • RSS
  • YouTube
  • Linkedin
  • Facebook