Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXJ1 polyclonal antibody (A01)

  • Catalog # : H00002302-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FOXJ1.
  • Immunogen:
  • FOXJ1 (NP_001445, 341 a.a. ~ 421 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002302-A01
    Western Blot detection against Immunogen (35.02 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2302
  • Gene Name:
  • FOXJ1
  • Gene Alias:
  • FKHL13,HFH-4,HFH4,MGC35202
  • Gene Description:
  • forkhead box J1
  • Gene Summary:
  • This gene encodes a member of the forkhead family of transcription factors. Similar genes in zebrafish and mouse have been shown to regulate the transcription of genes that control the production of motile cilia. The mouse ortholog also functions in the determination of left-right asymmetry. Polymorphisms in this gene are associated with systemic lupus erythematosus and allergic rhinitis
  • Other Designations:
  • forkhead-like 13
  • RSS
  • YouTube
  • Linkedin
  • Facebook