FOXF2 monoclonal antibody (M04), clone 2G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FOXF2 monoclonal antibody (M04), clone 2G10 Western Blot analysis of FOXF2 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
FOXF2 monoclonal antibody (M04), clone 2G10. Western Blot analysis of FOXF2 expression in Jurkat.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXF2 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.89 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXF2.
Immunogen
FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXF2 monoclonal antibody (M04), clone 2G10 Western Blot analysis of FOXF2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
FOXF2 monoclonal antibody (M04), clone 2G10. Western Blot analysis of FOXF2 expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXF2 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FOXF2
Entrez GeneID
2295GeneBank Accession#
NM_001452Protein Accession#
NP_001443Gene Name
FOXF2
Gene Alias
FKHL6, FREAC2
Gene Description
forkhead box F2
Omim ID
603250Gene Ontology
HyperlinkGene Summary
FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq
Other Designations
OTTHUMP00000017863|forkhead-like 6
-
Interactome
-
Disease
-
Publication Reference
-
Foxf2 represses bone formation via Wnt2b/β-catenin signaling.
Tomoyuki Tanaka, Akira Takahashi, Yutaka Kobayashi, Masanori Saito, Sun Xiaolong, Chen Jingquan, Yoshiaki Ito, Tsuyoshi Kato, Hiroki Ochi, Shingo Sato, Toshitaka Yoshii, Atsushi Okawa, Peter Carlsson, Hiroyuki Inose.
Experimental & Molecular Medicine 2022 Jun; 54(6):753.
Application：WB-Ce, Mouse, Mouse calvarial bones, ST2 cells.
-
Dual function of MAZ mediated by FOXF2 in basal-like breast cancer: Promotion of proliferation and suppression of progression.
Yu ZH, Lun SM, He R, Tian HP, Huang HJ, Wang QS, Li XQ, Feng YM.
Cancer Letters 2017 May; 402:142.
Application：WB-Tr, Human, BT549, MDA-MB-231 cells.
-
MicroRNA-301 Mediates Proliferation and Invasion in Human Breast Cancer.
Shi W, Gerster K, Alajez NM, Tsang J, Waldron L, Pintilie M, Hui AB, Sykes J, P'ng C, Miller N, McCready D, Fyles A, Liu FF.
Cancer Research 2011 Apr; 71(8):2926.
Application：WB, Human, MDA-MB-231 cells.
-
Foxf2 represses bone formation via Wnt2b/β-catenin signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com