Product Browser

Last updated: 2022/9/25
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXF2 monoclonal antibody (M04), clone 2G10 

  • Catalog # : H00002295-M04
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FOXF2.
  • Immunogen:
  • FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002295-M04
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 1.
  • Foxf2 represses bone formation via Wnt2b/β-catenin signaling.
    Tomoyuki Tanaka, Akira Takahashi, Yutaka Kobayashi, Masanori Saito, Sun Xiaolong, Chen Jingquan, Yoshiaki Ito, Tsuyoshi Kato, Hiroki Ochi, Shingo Sato, Toshitaka Yoshii, Atsushi Okawa, Peter Carlsson, Hiroyuki Inose.Exp Mol Med. 2022 Jun;54(6):753-764. doi: 10.1038/s12276-022-00779-z. Epub 2022 Jun 6.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FOXF2 monoclonal antibody (M04), clone 2G10 Western Blot analysis of FOXF2 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FOXF2 monoclonal antibody (M04), clone 2G10. Western Blot analysis of FOXF2 expression in Jurkat.
  • PDF DownloadProtocol Download
  • Immunofluorescence
  • Immunofluorescence enlargeenlarge this image
  • Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml]
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged FOXF2 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2295
  • Gene Name:
  • FOXF2
  • Gene Alias:
  • FKHL6,FREAC2
  • Gene Description:
  • forkhead box F2
  • Gene Summary:
  • FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017863,forkhead-like 6
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook