Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXG1B (Human) Recombinant Protein (Q01)

  • Catalog # : H00002290-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FOXG1B partial ORF ( NP_005240, 183 a.a. - 291 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002290-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2290
  • Gene Name:
  • FOXG1
  • Gene Alias:
  • BF1,BF2,FHKL3,FKH2,FKHL1,FKHL2,FKHL3,FKHL4,FOXG1A,FOXG1B,FOXG1C,HBF-1,HBF-2,HBF-3,HBF-G2,HBF2,HFK1,HFK2,HFK3,KHL2,QIN
  • Gene Description:
  • forkhead box G1
  • Gene Summary:
  • This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000178764,brain factor 2,forkhead box G1A,forkhead box G1B,forkhead box G1C,forkhead, drosophila, homolog-like 2,forkhead-like 1,forkhead-like 2,forkhead-like 3,forkhead-like 4,oncogene QIN
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook