FKBP5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FKBP5 MaxPab polyclonal antibody. Western Blot analysis of FKBP5 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of FKBP5 expression in transfected 293T cell line (H00002289-T01) by FKBP5 MaxPab polyclonal antibody.
Lane 1: FKBP5 transfected lysate(50.27 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to FKBP5 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FKBP5 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FKBP5 protein.
Immunogen
FKBP5 (NP_004108.1, 1 a.a. ~ 457 a.a) full-length human protein.
Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FKBP5 MaxPab polyclonal antibody. Western Blot analysis of FKBP5 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of FKBP5 expression in transfected 293T cell line (H00002289-T01) by FKBP5 MaxPab polyclonal antibody.
Lane 1: FKBP5 transfected lysate(50.27 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to FKBP5 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FKBP5 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — FKBP5
Entrez GeneID
2289GeneBank Accession#
NM_004117.2Protein Accession#
NP_004108.1Gene Name
FKBP5
Gene Alias
FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10
Gene Description
FK506 binding protein 5
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.[provided by RefSeq
Other Designations
51 kDa FK506-binding protein 5|54 kDa progesterone receptor-associated immunophilin|FF1 antigen|FK506-binding protein 5|HSP90-binding immunophilin|OTTHUMP00000016268|T-cell FK506-binding protein|peptidylprolyl cis-trans isomerase|rotamase
-
Interactome
-
Disease
-
Publication Reference
-
FKBP51 employs both scaffold and isomerase functions to promote NF-κB activation in melanoma.
Romano S, Xiao Y, Nakaya M, D'Angelillo A, Chang M, Jin J, Hausch F, Masullo M, Feng X, Romano MF, Sun SC.
Nucleic Acids Research 2015 Aug; 43(14):6983.
Application：IP-WB, WB-Tr, Human, A375 cells.
-
FKBP51 increases the tumour-promoter potential of TGF-beta.
Romano S.
Clinical and Translational Medicine 2014 Jan; 3(1):1.
Application：IP-WB, WB-Tr, Human, SAN cells.
-
FK506 binding protein 51 positively regulates melanoma stemness and metastatic potential.
Romano S, Staibano S, Greco A, Brunetti A, Nappo G, Ilardi G, Martinelli R, Sorrentino A, Di Pace A, Mascolo M, Bisogni R, Scalvenzi M, Alfano B, Romano MF.
Cell Death & Disease 2013 Apr; 4:e578.
Application：IP-WB, Human, SAN melanoma cells.
-
FKBP51 employs both scaffold and isomerase functions to promote NF-κB activation in melanoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com