FKBP4 monoclonal antibody (M01), clone 5C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in PC-12 ( Cat # L012V1 ).
Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11 Western Blot analysis of FKBP4 expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 0.5 ug/ml]
Immunoprecipitation
Immunoprecipitation of FKBP4 transfected lysate using anti-FKBP4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FKBP4 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FKBP4.
Immunogen
FKBP4 (AAH07924, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11. Western Blot analysis of FKBP4 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
FKBP4 monoclonal antibody (M01), clone 5C11 Western Blot analysis of FKBP4 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 0.5 ug/ml]Immunoprecipitation
Immunoprecipitation of FKBP4 transfected lysate using anti-FKBP4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FKBP4 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — FKBP4
Entrez GeneID
2288GeneBank Accession#
BC007924Protein Accession#
AAH07924Gene Name
FKBP4
Gene Alias
FKBP52, FKBP59, HBI, Hsp56, PPIase, p52
Gene Description
FK506 binding protein 4, 59kDa
Omim ID
600611Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. The human genome contains several non-transcribed pseudogenes similar to this gene. [provided by RefSeq
Other Designations
52 kD FK506 binding protein|FK506 binding protein 4 (59kD)|FK506 binding protein 52|FK506-binding protein 4 (59kD)|HSP binding immunophilin|T-cell FK506-binding protein, 59kD|p59 protein|peptidylprolyl cis-trans isomerase|rotamase
-
Interactome
-
Disease
-
Publication Reference
-
The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P.
Molecular & Cellular Proteomics 2014 Dec; 13(12):3585.
Application：WB-Ce, Human, PC-3 cells.
-
Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women.
Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J.
Clinical Cancer Research 2009 Jul; 15(14):4733.
Application：ELISA, IHC-P, WB, Human, Breast tissues, Serum.
-
The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com