FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FKBP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of FKBP3 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of FKBP3 expression in transfected 293T cell line (H00002287-T01) by FKBP3 MaxPab polyclonal antibody.
Lane 1: FKBP3 transfected lysate(25.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FKBP3 protein.
Immunogen
FKBP3 (NP_002004.1, 1 a.a. ~ 224 a.a) full-length human protein.
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FKBP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of FKBP3 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of FKBP3 expression in transfected 293T cell line (H00002287-T01) by FKBP3 MaxPab polyclonal antibody.
Lane 1: FKBP3 transfected lysate(25.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FKBP3
Entrez GeneID
2287GeneBank Accession#
NM_002013.2Protein Accession#
NP_002004.1Gene Name
FKBP3
Gene Alias
FKBP-25, PPIase
Gene Description
FK506 binding protein 3, 25kDa
Omim ID
186947Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq
Other Designations
FK506 binding protein 3 (25kD)|FK506-binding protein 25, T-cell|FK506-binding protein 3 (25kD)|peptidyl-prolyl cis-trans isomerase|rapamycin binding protein|rapamycin-selective 25 kDa immunophilin|rotamase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com