Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FKBP3 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00002287-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FKBP3 protein.
  • Immunogen:
  • FKBP3 (NP_002004.1, 1 a.a. ~ 224 a.a) full-length human protein.
  • Sequence:
  • MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • FKBP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of FKBP3 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FKBP3 expression in transfected 293T cell line (H00002287-T01) by FKBP3 MaxPab polyclonal antibody.

    Lane 1: FKBP3 transfected lysate(25.20 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 2287
  • Gene Name:
  • FKBP3
  • Gene Alias:
  • FKBP-25,PPIase
  • Gene Description:
  • FK506 binding protein 3, 25kDa
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq
  • Other Designations:
  • FK506 binding protein 3 (25kD),FK506-binding protein 25, T-cell,FK506-binding protein 3 (25kD),peptidyl-prolyl cis-trans isomerase,rapamycin binding protein,rapamycin-selective 25 kDa immunophilin,rotamase
  • RSS
  • YouTube
  • Linkedin
  • Facebook