Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FKBP1B (Human) Recombinant Protein (P01)

  • Catalog # : H00002281-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FKBP1B full-length ORF ( AAH02614, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.54
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002281-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2281
  • Gene Name:
  • FKBP1B
  • Gene Alias:
  • FKBP12.6,FKBP1L,OTK4,PKBP1L,PPIase
  • Gene Description:
  • FK506 binding protein 1B, 12.6 kDa
  • Gene Summary:
  • The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • FK506-binding protein 1-like,FK506-binding protein 12.6,OTTHUMP00000116040,OTTHUMP00000116041,calstabin 2,immunophilin FKBP12.6,peptidyl-prolyl cis-trans isomerase,rotamase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook